PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2KG080500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRF
Protein Properties Length: 610aa    MW: 63302.6 Da    PI: 7.955
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2KG080500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.79.6e-24231274245
                  WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                           epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  Pavir.2KG080500.1.p 231 LEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKHVEG 274
                          69***************************************986 PP

2QLQ591.4e-20163199137
                  QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                          ++FT++Q+ +L++Q+l+yKyLaan P+Pp Ll++i++
  Pavir.2KG080500.1.p 163 GPFTPSQWIELEHQALIYKYLAANSPIPPSLLVPIRR 199
                          59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.7E-12163199IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.503164199IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.4E-15164198IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.65230274IPR014977WRC domain
PfamPF088795.2E-20232273IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 610 aa     Download sequence    Send to blast
MSATSTRAKG AARRASGGGG GAMELGGVVM DAGGGAAELG LLGGGSSRLL KHGRGNAAAG  60
GEEHGWGARA AKQARAAADA AEAAKAAVAP FLLGSCSPSH GGEQMLSFSS AAASSCASTA  120
AVAAAAAADG AMPLYYGTPA SCSGLSSVSL CSSMQGAMAR VRGPFTPSQW IELEHQALIY  180
KYLAANSPIP PSLLVPIRRS IASSPYPPSY FGTSTLGWGS FQLGYSGNAD LEPGRCRRTD  240
GKKWRCSRDA VADQKYCERH MNRGRHRSRK HVEGQPGHAA KAMSAAVAAA AATQPPALAA  300
SGAGASAAGL TVSQHQQPVK SYSAGATDPC SLQYNRELVN KQNESDNMQD SDNLSMLTSM  360
STRNPGSLFP FSKQNNPFEV TSSRLEFGLV SSDSLMSSPH SSLEHVNLLS SQSLNENQSS  420
ASLQHFVDWP RTPAQGGLSW ADAEDMQAQR SQLSISAPMA SSELSSASTS PIHEKLMLSP  480
LKLSREYSPI GLSIAASRDE VSQLEANWAT MFRDSSMGGP LGEVLTKNGN GEARNCLRAP  540
LNLLTDCWDS SPGMESSPVG VLQKTTFGSV SSSTGSSPRM ENHGAYDGIS NLRDDLGSIV  600
VNHPSIRLM*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.59860.0callus| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981896.10.0PREDICTED: growth-regulating factor 6-like
SwissprotQ6AWY30.0GRF6_ORYSJ; Growth-regulating factor 6
TrEMBLK4A7G60.0K4A7G6_SETIT; Uncharacterized protein
STRINGSi034822m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42903568
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.13e-48growth-regulating factor 2